Protein (Ensembl Accession #) Peptide Sequence Peptide number Chromosome Scaffold Name START END Orientation
TRIO protein
(ENSANGP00000017522)
ALEPLQK JHU_0001 2R AAAB01008987 12220927 12220947 -
QVLDAWK JHU_0002 2R AAAB01008987 12220948 12220968 -
FNTPIDGK JHU_0003 2R AAAB01008987 12220243 12220266 -
GWLSVSQQEK JHU_0004 2R  AAAB01008987   12221191 12221220 _
NSFATLVSIAR JHU_0005 2R AAAB01008987 12220567 12220599 -
HFPDHFDTLR JHU_0006 2R AAAB01008987 12220537 12220566 -
TLFEPMKADLAK JHU_0007 2R AAAB01008987 12220990 12221025 -
SMYDLIGQLVQSSK JHU_0008 2R AAAB01008987 12220720 12220761 -
LSQLAHAMPSLVDVK JHU_0009 2R AAAB01008987 12220312 12220356 -
AHPDLQQSVDDLMAK JHU_0010 2R AAAB01008987 3188 3232 -
SPTGSLGGKDVVSK JHU_0011 2R  AAAB01008987 12221053 12221094 -
Putative apyrase precursor
(ENSANGP00000015382)
VLSIDVR JHU_0012 3L AAAB01008986 6263217 6263237 -
LNVAQVAGLR JHU_0013 3L  AAAB01008986 6263274 6263303 -
STDPFPALPR JHU_0014 3L  AAAB01008986 6264386 6264415 -
VFHTVQELR JHU_0015 3L  AAAB01008986 6264710 6264736 -
VVNESNLVGGR JHU_0016 3L  AAAB01008986 6263007 6263039 -
AAEEGDTCIAGIAR JHU_0017 3L  AAAB01008986   6264737 6264778 -
NLNDGVSYEPLNR JHU_0018 3L  AAAB01008986 6263178 6263216 -
IAQTTVDLVQATCR JHU_0019 3L  AAAB01008986 6263629 6263670 -
Putative 5'-nucleotidase precursor
(ENSANGP00000016300/
ENSANGP00000012716 )
ELEPWR JHU_0020 3L AAAB01008823 77984 78001 +
ELEPWR JHU_0020 Unknown AAAB01008546 8658 8675 +
ECIAGIAR JHU_0022 3L AAAB01008823 76915 76938 +
ECIAGIAR JHU_0022 Unknown AAAB01008546 7589 7612 +
SFGKYVGR JHU_0024 3L AAAB01008823 77861 77884 +
SFGKYVGR JHU_0024 Unknown AAAB01008546 8535 8558 +
TMFQEKR JHU_0026 3L  AAAB01008823 78730 78750 +
TMFQEKR JHU_0026 Unknown AAAB01008546 9404 9424 +
VGVIGALYDK JHU_0028 3L  AAAB01008823 77345 77374 +
VGVIGALYDK JHU_0028 Unknown  AAAB01008546 8019 8048 +
IPTVVANLEK JHU_0030 3L  AAAB01008823   77246 77275 +
IPTVVANLEK JHU_0030 Unknown  AAAB01008546 7920 7949 +
GLAPYLAELEK JHU_0032 3L  AAAB01008823 77207 77239 +
GLAPYLAELEK JHU_0032 Unknown  AAAB01008546 7881 7913 +
VQSIDIVGANGAK JHU_0034 3L  AAAB01008823   78526 78564 +
VQSIDIVGANGAK JHU_0034 Unknown  AAAB01008546   9200 9238 +
MKIPTVVANLEK JHU_0036 3L  AAAB01008823 77240 77275 +
MKIPTVVANLEK JHU_0036 Unknown  AAAB01008546 7914 7949 +
YDTIEGDYPLVVK JHU_0038 3L  AAAB01008823   77711 77749 +
YDTIEGDYPLVVK JHU_0038 Unknown  AAAB01008546   8385 8423 +
SSTCTNSKECIAGIAR JHU_0040 3L  AAAB01008823   76891 76938 +
SSTCTNSKECIAGIAR JHU_0040 Unknown  AAAB01008546   7565 7612 +
VTGPLDSDVLIEYVR JHU_0042 3L AAAB01008823 78664 78708 +
VTGPLDSDVLIEYVR JHU_0042 Unknown AAAB01008546 9338 9382 +
LSGADLWSAIDHSFTLDDEFR JHU_0044 3L AAAB01008823 78397 78459 +
LSGADLWSAIDHSFTLDDEFR JHU_0044 Unknown AAAB01008546 9071 9133 +
DQIYYVVVPSYLADGKDGFAMLK JHU_0046 3L AAAB01008823 78580 78648 +
DQIYYVVVPSYLADGKDGFAMLK JHU_0046 Unknown AAAB01008546 9254 9322 +
TKNPLYLNAGDNFQGTLWYNLLR JHU_0048 3L AAAB01008823  76978 77046 +
TKNPLYLNAGDNFQGTLWYNLLR JHU_0048 Unknown AAAB01008546 7652 7720 +
LSGADLWSAIDHSFTLDDEFRYNTAQVSGMAVVADLSK JHU_0050 3L AAAB01008823 78397 78510 +
LSGADLWSAIDHSFTLDDEFRYNTAQVSGMAVVADLSK JHU_0050 Unknown AAAB01008546 9071 9184 +
D7r4 protein
(ENSANGP00000018328)
VFDLMELK JHU_0052 3R AAAB01008964 3841642 3841665 +
KVFDLMELK JHU_0053 3R AAAB01008964 3841639 3841665 +
YTAEFVQIMK JHU_0054 3R AAAB01008964 3841696 3841725 +
LYDPLNIIELDK JHU_0055 3R AAAB01008964 3841486 3841521 +
CIGECVQVPTSER JHU_0056 3R  AAAB01008964   3841546 3841584 +
 LYDPLNIIELDKR JHU_0057 3R AAAB01008964 3841486 3841524 +
YEIIEGPEMDKHIHCVMR JHU_0058 3R AAAB01008964 3841316 3841369 +
RYEIIEGPEMDKHIHCVMR JHU_0059 3R AAAB01008964 3841313 3841369 +
ALDFVYEDGRGDYHK JHU_0060 3R AAAB01008964 3841370 3841405 +
ALDFVYEDGRGDYHK JHU_0060 3R AAAB01008965 3841477 3841485 +
D7-related 2 protein
(ENSANGP00000018371)
NIGDSLKDR JHU_0062 3R AAAB01008964 3839737 3839763 +
NAVDYNELLK JHU_0063 3R AAAB01008964 3840106 3840135 +
ESVLLELLQR JHU_0064 3R AAAB01008964 3839944 3839973 +
VDSGVNHAANMK JHU_0065 3R AAAB01008964 3839974 3840009 +
MQTSDPFDMNR JHU_0066 3R AAAB01008964 3840145 3840177 +
VDSGVNHAANMKK JHU_0067 3R AAAB01008964 3839974 3840012 +
QYTPVSSDDMDK JHU_0068 3R AAAB01008964 3839779 3839814 +
VAALIKEIDDGLC JHU_0069 3R AAAB01008964 3840178 3840216 +
ANTFYTCFLGTSSLAGFK JHU_0070 3R AAAB01008964 3840052 3840105 +
ESTVEECEKNIGDSLKDR JHU_0071 3R AAAB01008964 3839710 3839763 +
KANTFYTCFLGTSSLAGFK JHU_0072 3R AAAB01008964 3840049 3840105 +
ANTFYTCFLGTSSLAGFKNAVDYNELLK JHU_0073 3R AAAB01008964 3840052 3840135 +
CVTEASTSGSDKKANTFYTCFLGTSSLAGFK JHU_0074 3R AAAB01008964 3840013 3840105 +
QYTPVSSDDMDKHMQCVLEVVGFVDGNGEVK JHU_0075 3R AAAB01008964 3839779 3839871 +
QYTPVSSDDMDKHMQCVLEVVGFVDGNGEVKESVLLELLQR JHU_0076 3R AAAB01008964 3839944 3839973 +
D7-related 3 protein
(ENSANGP00000018330/
ENSANGP00000025880)
YAVDYVELLR JHU_0077 3R AAAB01008964 3838283 3838312 +
MVDPDGDHAGSMK JHU_0078 3R AAAB01008964 3838148 3838186 +
MVDPDGDHAGSMKK JHU_0079 3R AAAB01008964 3838148 3838189 +
ANTFYTCFLGTSSAQAFK JHU_0080 3R AAAB01008964 3838229 3838282 +
AGKLDMGTTFNAGQVSALMK JHU_0081 3R AAAB01008964 3838313 3838372 +
D7-related 1 protein
(ENSANGP00000018340)
SQLCEIR JHU_0082 3R AAAB01008964 3836679 3836699 +
SQLCEIRK JHU_0083 3R AAAB01008964 3836679 3836702 +
VFDTVELVK JHU_0084 3R AAAB01008964 3837034 3837060 +
CGGQTQHLPVGK JHU_0085 3R AAAB01008964 3836938 3836973 +
CGGQTQHLPVGKR JHU_0086 3R AAAB01008964 3836938 3836976 +
CLVESTSGEAFKK JHU_0087 3R AAAB01008964 3836995 3837033 +
KLPALSQYSSVVDK JHU_0088 3R AAAB01008964 3837067 3837108 +
ALDFVRPDGTGDYHK JHU_0089 3R AAAB01008964 3836757 3836792 +
ALDFVRPDGTGDYHK JHU_0090 3R AAAB01008964 3836757 3836792 +
LLDTPDMDKHMDCVMK JHU_0091 3R AAAB01008964 3836709 3836756 +
Antigen 5-related 1 protein
(ENSANGP00000021028/
ENSANGP00000023200)
SCNYGHDR JHU_0092 2L AAAB01008960 17749758 17749781 +
IRPYPSAVK JHU_0093 2L AAAB01008960 17749674 17749700 +
FTEKDLIHK JHU_0094 2L AAAB01008960 17749851 17749877 +
VGCSMWYWK JHU_0095 2L AAAB01008960 17750082 17750108 +
FPGLCNASEEPR JHU_0096 2L AAAB01008960 17750229 17750264 +
SVYQSGPTASQCK JHU_0097 2L AAAB01008960 17750172 17750210 +
NSKFPGLCNASEEPR JHU_0098 2L AAAB01008960 17750220 17750264 +
GGPHVGCNPPSSSGGPTCQGK JHU_0099 2L AAAB01008960 17749518 17749580 +
YPSSYSGKPIGHFTQIASDR JHU_0100 2L AAAB01008960 17750034 17750072 +
YPSSYSGKPIGHFTQIASDR JHU_0101 2L AAAB01008980 16136200 16136214 +
KYPSSYSGKPIGHFTQIASDR JHU_0102 2L AAAB01008980 17750034 17750072 +
KYPSSYSGKPIGHFTQIASDR JHU_0102 2L AAAB01008980 16136197 16136214 +
FVSSWWSEYLDARPEHVR JHU_0104 2L AAAB01008960 17749878 17749931 +
KFPYAGQNIAITQFFGYR JHU_0105 2L AAAB01008960 17749797 17749850 +
MPTLTWDPELASLADANAR JHU_0106 2L AAAB01008960 17749701 17749757 +
Histone H3
(ENSANGP00000016005)
FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK JHU_0107 2R AAAB01008978 6337 6432 +
Histone H3
(ENSANGP00000015258)
JHU_0107 2L AAAB01008948 3301269 3301364 +
Histone H3
(ENSANGP00000001387)
JHU_0107 Unknown AAAB01007051 250 345 +
Histone H3
(ENSANGP00000016172)
JHU_0107 Unknown AAAB01008468 1884 1979 -
Histone H3
(ENSANGP00000025641)
JHU_0107 Unknown AAAB01008468 11126 11221 -
Histone H3
(ENSANGP00000012784)
JHU_0107 Unknown AAAB01007568 12580 12675 +
Histone H3
(ENSANGP00000016200)
JHU_0107 Unknown AAAB01008456 15219 15314 +
D7-related 5 protein
(ENSANGP00000018321)
GVEADRYVQCFMTALGFADESGSIQR JHU_0114 3R AAAB01008964 3842270 3842344 +
gSG6 protein
(ENSANGP00000019455)
FCTLCDTR JHU_0115 X AAAB01008846 8902958 8902981 +
SMHDVLCDR JHU_0116 X AAAB01008846 8903087 8903113 +
HFCECKETR JHU_0117 X AAAB01008846 8902982 8903008 +
VYCGHLDCTR JHU_0118 X AAAB01008846 8902904 8902933 +
SMHDVLCDRIDQAFLEQ JHU_0119 X AAAB01008846 8903087 8903137 +
EPLPYMYACPGTEPCQSSDR JHU_0120 X AAAB01008846 8903009 8903068 +
ETREPLPYMYACPGTEPCQSSDR JHU_0121 X AAAB01008846 8903000 8903068 +
HFCECKETREPLPYMYACPGTEPCQSSDR JHU_0122 X AAAB01008846 8902982 8903068 +
Calreticulin
(ENSANGP00000012895)
HEQNIDCGGGYLK JHU_0123 2R AAAB01008880 2345932 2345970 -
TWVQSEHKGVEYGK JHU_0124 2R AAAB01008880 2347798 2347839 -
FYNDAEADKGLQTSQDAR JHU_0125 2R AAAB01008880 2347747 2347776 -
FYNDAEADKGLQTSQDAR JHU_0125 2R AAAB01008880 2347747 2347776 -
D7 protein long form
(ENSANGP00000025174)
SDLEPEVR JHU_0127 3R AAAB01008964 3853135 3853158 -
NAMDCVFR JHU_0128 3R AAAB01008964 3855167 3855190 -
IYEAKPEIK JHU_0129 3R AAAB01008964 3855305 3855331 -
SANYGYLAMGK JHU_0130 3R AAAB01008964 3854868 3854900 -
NAFYFHELR JHU_0131 3R AAAB01008964 3854901 3854927 -
DYELADSAEFR JHU_0132 3R AAAB01008964 3855191 3855223 -
KIYHGTVDSVAK JHU_0133 3R AAAB01008964 3855332 3855367 -
LRDYELADSAEFR JHU_0134 3R AAAB01008964 3855191 3855229 -
QEESFFAYCAK JHU_0135 3R AAAB01008964 3855269 3855301 -
CTLAGLQMYDEK JHU_0136 3R AAAB01008964 3855624 3855659 -
KQEESFFAYCAK JHU_0137 3R AAAB01008964 3855269 3855304 -
IRDYELADSAEFR JHU_0138 3R AAAB01008964 3855191 3855226 -
ALDPEEAWYVYER JHU_0139 3R AAAB01008964 3855768 3855806 -
YMDDSGLKVDEVVR JHU_0140 3R AAAB01008964 3855134 3855157 -
YMDDSGLKVDEVVR JHU_0140 3R AAAB01008964 3855057 3855074 -
DFNLINKSDLEPEVR JHU_0142 3R AAAB01008964 3855012 3855056 -
TNTFKPETVPVQHEAYK JHU_0143 3R AAAB01008964 3855506 3855541 -
PETVPVQHEAYK  JHU_0144 3R AAAB01008964 3855506 3855541 -
SVLASCTGTQAYDYYSCLLNSPVKEDFR JHU_0145 3R AAAB01008964 3854928 3855011 -
VNELQQALSSLNAGSGSCAEVFNAYLPVHNK JHU_0146 3R AAAB01008964 3855386 3855478 -
SFTEVESSKVNELQQALSSLNAGSGSCAEVFNAYLPVHNK JHU_0147 3R AAAB01008964 3855386 3855505 -
SG1 protein
(ENSANGP00000007337)
MMLLQINQR JHU_0148 X AAAB01008846 224946 224972 -
LAFLSQNADAR JHU_0149 X AAAB01008846 225207 225239 -
ELDKCESFVK JHU_0150 X AAAB01008846 224874 224903 -
SLVLMSVQGGASK JHU_0151 X AAAB01008846 225495 225533 -
DSYLAMIAALDLGK JHU_0152 X AAAB01008846 225240 225281 -
DANRDYDHYLQESK JHU_0153 X AAAB01008846 224763 224804 -
Hypothetical 10.2 kDa protein
(ENSANGP00000018379)
QEATANDPQHDCSDSIQR JHU_0154 3R AAAB01008964 3589813 3589866 -
Hypothetical 8.8 kDa protein precursor
(ENSANGP00000004315)
DKPDIDPVDFLVDVIK JHU_0155 2L AAAB01008960 19057831 19057878 -
Hypothetical 9.7 kDa protein
(ENSANGP00000019451)
MAMTGGGILGGIFSAL JHU_0156 X AAAB01008960 19057831 19057878 -
gSG1-like 2 protein precursor
(ENSANGP00000017327)
QHIANLLEFIR JHU_0157 X AAAB01008846 1470006 1470038 -
DRQHIANLLEFIR JHU_0158 X AAAB01008846 1470006 1470044 -
QFGGTLLPLLNSAQVK JHU_0159 X AAAB01008846 1470201 1470248 -
KDPATAGLVTEVQNIFGR JHU_0160 X AAAB01008846 1469442 1469495 -
YDLFLLDEHHPQLFDLLFDR JHU_0161 X AAAB01008846 1469706 1469765 -
ALLTGANRYDLFLLDEHHPQLFDLLFDR JHU_0162 X AAAB01008846 1469706 1469789 -
ACTIN
(ENSANGP00000019055)
GYSFTTTAER JHU_0163 X AAAB01008847 338011 338040 -
EITALAPSTMK JHU_0164 X AAAB01008847 337651 337683 -
MQKEITALAPSTMK JHU_0165 X AAAB01008847 337651 337692 -
VAPEEHPVLLTEAPLNPK JHU_0166 X AAAB01008847 338290 338343 -
ENSANGP00000016398 GYSFTTTAER JHU_0163 UNKN AAAB01006483 16693 16722 +
VAPEEHPVLLTEAPLNPK JHU_0166 UNKN AAAB01006483 16390 16443 +
ENSANGP00000022175 GYSFTTTAER JHU_0163 2R AAAB01008987 8219803 8219832 +
VAPEEHPVLLTEAPLNPK JHU_0166 2R AAAB01008987 8219500 8219553 +
ENSANGP00000009996 GYSFTTTAER JHU_0163 2L AAAB01008900 1446854 1446883 +
VAPEEHPVLLTEAPLNPK JHU_0166 2L AAAB01008900 1446551 1446604 +
ENSANGP00000015027 GYSFTTTAER JHU_0163 UNKN AAAB01008916 98978 99007 +
VAPEEHPVLLTEAPLNPK JHU_0166 UNKN AAAB01008916 98675 98728 +
ENSANGP00000022306 GYSFTTTAER JHU_0163 3L AAAB01008956 302301 302330 +
VAPEEHPVLLTEAPLNPK JHU_0166 3L AAAB01008956 301998 302051 +
ENSANGP00000022307 GYSFTTTAER JHU_0163 3L AAAB01008956 307998 308027 +
VAPEEHPVLLTEAPLNPK JHU_0166 3L AAAB01008956 307695 307748 +
ENSANGP00000015039 GYSFTTTAER JHU_0163 UNKN AAAB01008916 72749 72778 -
VAPEEHPVLLTEAPLNPK JHU_0166 UNKN AAAB01008916 73028 73081 -
ENSANGP00000022308 GYSFTTTAER JHU_0163 3L AAAB01008956 283130 283159 -
VAPEEHPVLLTEAPLNPK JHU_0166 3L AAAB01008956 283409 283462 -
gSG1-like 1 protein
(ENSANGP00000019154)
LFEQIGAK JHU_0167 X AAAB01008846 228945 228968 -
EIVQFATK JHU_0168 X AAAB01008846 228978 229001 -
FFADHLAK JHU_0169 X AAAB01008846 228780 228803 -
LKGQFADFDR JHU_0170 X AAAB01008846 228669 228698 -
ELEWKDELVK JHU_0171 X AAAB01008846 228699 228728 -
TLYQLLQPEIMK JHU_0172 X AAAB01008846 229158 229193 -
Lysozyme precursor
(ENSANGP00000022875)
YWCDSGYGSNDCK JHU_0173 2L AAAB01008807 3382966 3383004 +
Hypothetical 46.5 kDa protein
(ENSANGP00000023463)
LNHWHDDHPFLLETVAK JHU_0174 X AAAB01008846 232761 232811 -
GQWKPDQIVSAIQDGYHVNPTIMEHLLEFVR JHU_0175 X AAAB01008846 232518 232610 -
AHLEEILPTLALETEK JHU_0176 X AAAB01008846 232044 232091 -
TVEQTGKSSAELVR JHU_0177 X AAAB01008846 231993 232034 -
LFEIASLFK JHU_0178 X AAAB01008846 232170 232196 -
FAAIEQLLK JHU_0179 X AAAB01008846 232128 232154 -
LVPELQRK JHU_0180 X AAAB01008846 232677 232700 -
DNFLFR JHU_0181 X AAAB01008846 232812 232829 -
Saglin
(ENSANGP00000019156)
QLQTSLATIELK JHU_0182 X AAAB01008846 230569 230604 -
QFDICEQFIGR JHU_0183 X AAAB01008846 230389 230421 -
GKFATFAK JHU_0184 X AAAB01008846  230320 230343 -
DIPSVEER JHU_0185 X AAAB01008847 230842 230865 -
QLEELRGK JHU_0186 X AAAB01008846 230338 230361 -
SLYQLAQR JHU_0187 X AAAB01008846 230815 230838 -
VLLSQIGDR JHU_0188 X AAAB01008846 230464 230490 -
QLDALTDSR JHU_0189 X AAAB01008846 231055 231081 -
QLYDDLVR JHU_0190 X AAAB01008846 230695 230718 -
VTIYQDQR JHU_0191 X AAAB01008846 230893 230916 -
RSLYQLAQR JHU_0192 X AAAB01008846 230815 230841 -
EDLPVYQANR JHU_0193 X AAAB01008846 230719 230748 -
LKEQVANGNFK JHU_0194 X AAAB01008846 230647 230679 -
VLLSQIGDREK JHU_0195 X AAAB01008846 230458 230490 -
GKNYQHYLSESR JHU_0196 X AAAB01008846 230284 230319 -
FVPYANALPQPAQR JHU_0197 X AAAB01008846 230506 230547 -
GKNYQHYLSESRK JHU_0198 X AAAB01008846 230281 230319 -
AAAGPAPDPSSQFCQQLLDDAQR JHU_0199 X AAAB01008846 231190 231258 -
SLHGGSMQPDGTCDNLWESFLSQFHQVR JHU_0200 X AAAB01008846 231286 231369 -
ENSANGP00000029569 NLLGGTDGPK JHU_0201 3R AAAB01008980 9142989 9143018 -
ELNELLVAAK JHU_0202 3R AAAB01008980 9144867 9144896 -
ASNTISLVTVR JHU_0203 3R AAAB01008980 9141657 9141689 -
HAVVYDTQTNNPQEIQVVAPR JHU_0204 3R AAAB01008980 9141786 9141848 -
ENSANGP00000027299 LLDEDTIR JHU_0205 3R AAAB01008980 9149255 9149278 +
SQNGNSFLTLSQPEHK JHU_0206 3R AAAB01008980 9150086 9150133 +
SFLTTDCTNPSLCHGR  JHU_0207 3R AAAB01008980 9152969 9153016 +
TLYGDMNDDLPFVCGKR JHU_0208 3R AAAB01008980 9152693 9152743 +
ENSANGP00000027791 SFLTTDCTNPSLCHGR  JHU_0207 3R AAAB01008980 9138153 9138200 -
TLYGDMNDDLPFVCGKR JHU_0208 3R AAAB01008980 9138426 9138476 -
ENSANGP00000015826 LGIMEDPSNR JHU_0209 2R AAAB01008987 11471655 11471684 +
WLNDVALKDK JHU_0210 2R AAAB01008987 11472039 11472068 +  
QDLVNNLGTIAK JHU_0211 2R AAAB01008987 11470626 11470661 +
QDNIYFIAGPNR JHU_0212 2R AAAB01008987 11471781 11471816 +
GVVDSDDLPLNVSR JHU_0213 2R AAAB01008987 11471481 11471522 +
NKEYTSLSDYVAR JHU_0214 2R AAAB01008987 11471730 11471768 +
EGFTLNESEESKAR JHU_0215 2R AAAB01008987 11471958 11471999 +
KVSDVTDEEYTEFYK JHU_0216 2R AAAB01008987 11471217 11471261 +
ENSANGP00000027211/
ENSANGP00000018385
FSVSGYPTLK JHU_0217 2L AAAB01008807 3077702 3077731 -
LKDEAVSIVK JHU_0218 2L AAAB01008807 3076751 3076780 -
LTPTLEELGTK JHU_0219 2L AAAB01008807 3076781 3076813 -
SEPVPESNDGPVK JHU_0220 2L AAAB01008807 3076910 3076948 -
DLLTVEAFEAFLK JHU_0221 2L AAAB01008807 3077583 3077602 -
DLLTVEAFEAFLK JHU_0221 2L AAAB01008807 3077564 3077582 -
ENSANGP00000026077/
ENSANGP00000011666
ELETVEAAEEFLKENNVAVVGFFK JHU_0223 3L AAAB01008986 198745 198816 +
TLEGFVK JHU_0224 3L AAAB01008986 199711 199731 +
ALAPEYAK JHU_0225 3L AAAB01008986 198511 198534 +
KDEVPSLR JHU_0226 3L AAAB01008986 199255 199278 +
FDEVAFDK JHU_0227 3L AAAB01008986 199459 199482 +
QLVPIYDK JHU_0228 3L AAAB01008986 199534 199557 +
TEDGVLVLTK JHU_0229 3L AAAB01008986 195275 195304 +
ILEFFGMK JHU_0230 3L AAAB01008986 199231 199254 +
ILEFFGMKK JHU_0231 3L AAAB01008986 199231 199257 +
VDATVEPELAEK JHU_0232 3L AAAB01008986 198583 198618 +
IDATANELEHTK JHU_0233 3L AAAB01008986 199603 199638 +
QLVPIYDKLGEK JHU_0234 3L AAAB01008986 199534 199569 +
ENSANGP00000019887 DAGTISGLNVLR JHU_0235 2R AAAB01008987 1393336 1393371 -
TTPSYVAFTDTER JHU_0236 2R AAAB01008987 1393702 1393740 -
ENSANGP00000020184 DDLFNTNASIVR JHU_0237 2R AAAB01008987 4245851 4245886 -
ENSANGP00000024604 APGIIPR JHU_0238 2L AAAB01008900 1832858 1832878 +
AVDSLVPIGR JHU_0239 2L AAAB01008900 1832915 1832944 +
ALLQQIASEGK JHU_0240 2L AAAB01008900 1834034 1834066 +
ENSANGP00000011028 AYYGVLKK JHU_0241 2R AAAB01008888 480906 480929 +
ENSANGP00000026049 FAEIVQLR JHU_0242 2R AAAB01008859 2861383 2861406 -
ENSANGP00000017331/
ENSANGP00000023320/
ENSANGP00000026049
AKLEEEIR JHU_0243 X AAAB01008846 1308521 1308544 -
ENSANGP00000021319 GYADFCVR JHU_0244 X AAAB01008847 3110330 3110353 +
GIVDESVTGVHR JHU_0245 X AAAB01008847 3115681 3115716 +
ENSANGP00000021797 NIVWNIDNPK JHU_0246 2L AAAB01008960 4595427 4595456 -
ENSANGP00000013302 LSNVFIIGK JHU_0247 2L AAAB01008807 10078965 10078991 +
ENSANGP00000011648 FINEQLYPVAK JHU_0248 2R AAAB01008898 3705070 3705102 +
AQLKDGAFPTKR JHU_0249 2R AAAB01008898 3705325 3705360 +
ENSANGP00000020140 DIAEAALAEAK JHU_0250 2R AAAB01008987 4123952 4123984 -  
ENSANGP00000021424 GISQGLADNTVIAR JHU_0251 3R AAAB01008984 2314698 2314739 +
ENSANGP00000018478 AVENSGTVIGLR JHU_0252 2R AAAB01008987 3219769 3219804 -
ENSANGP00000022049
ENSANGP00000028292
VLEQLTNQTPVYSK JHU_0253 3L AAAB01008816 3628997 3629038 -
ENSANGP00000011974 MNPDGLAALAR JHU_0254 X AAAB01008847 1817570 1817602 +
ENSANGP00000021580 GDLGIEIPAEK JHU_0255 2R AAAB01008952 838760 838792 +
ENSANGP00000012700 ADQLTEEQIAEFKEAFSLFDKDGDGTITTK JHU_0256 3L AAAB01008823 859568 859657 -
SLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMAR JHU_0257 3L AAAB01008823 859442 859546 -
SLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMAR JHU_0257 3L AAAB01008823 844704 844751 -
ENSANGP00000000129  ADQLTEEQIAEFKEAFSLFDKDGDGTITTK JHU_0259 Unknown AAAB01001629 1296 1385 -
SLGQNPTEAELQDMINEVDADG JHU_0260 Unknown AAAB01001629 1209 1274 -
ENSANGP00000000593/
ENSANGP00000028058
ALDIQR JHU_0261 3L AAAB01008848 1352310 1352327 -
ALDIQR JHU_0261 3L AAAB01008848 1363551 1363568 -
HFLFR JHU_0262 3L AAAB01008848 1352358 1352372 -
ARPLWNDEK JHU_0263 3L AAAB01008848 1352831 1352857 -
TTLVNMQFGQLVAHDMGLR JHU_0264 3L AAAB01008848 1353347 1353403 -
ILCDNTPGVAQMQQR JHU_0265 3L AAAB01008848 1351854 1351898 -
ILCDNTPGVAQMQQR JHU_0266 3L AAAB01008848 1363096 1363140 -
AFAGAININDHMFNPTVLER JHU_0267 3L AAAB01008848 1352457 1352516 -
ENSANGP00000019589 ALDIQR JHU_0261 3R AAAB01008984 5574286 5574324 -
ENSANGP00000010602 ALDIQR JHU_0261 3L AAAB01008816 2414272 2414310 -
ENSANGP00000012177 HFLFR JHU_0262 2R AAAB01008859 86745018 8675032 +
ENSANGP00000018189 HFLFR JHU_0262 2R AAAB01008859 972870 972884 +
ENSANGP00000018267 HFLFR JHU_0262 2R AAAB01008859 972870 972884 +
ENSANGP00000012513 HFLFR JHU_0262 3L AAAB01008823 1872160 1872174 +
ENSANGP00000012538 HFLFR JHU_0262 3L AAAB01008823 1875187 1875201 +
ENSANGP00000022051 HFLFR JHU_0262 X AAAB01008846 4108438 4108452 +
ENSANGP00000000794 HFLFR JHU_0262 2R AAAB01008851 1354432 1354446 +
ENSANGP00000018921 HFLFR JHU_0262 UNKN AAAB01008895 12676 12690 +
ENSANGP00000018095 HFLFR JHU_0262 UNKN AAAB01008934 63844 63858 +
ENSANGP00000029058 HFLFR JHU_0262 UNKN AAAB01001427 566 580 +
ENSANGP00000012402 HFLFR JHU_0262 3L AAAB01008823 1878338 1878352 +
ENSANGP00000018890 HFLFR JHU_0262 2R AAAB01008844 1336943 1336957 +
ENSANGP00000026060 HFLFR JHU_0262 3L AAAB01008849 2578256 2578270 +
ENSANGP00000003165 HFLFR JHU_0262 2R AAAB01008879 786062 786076 +
ENSANGP00000022667 HFLFR JHU_0262 2R AAAB01008880 2596049 2596063 +
ENSANGP00000012843 HFLFR JHU_0262 2R AAAB01008880 2596049 2596063 +
ENSANGP00000011842 HFLFR JHU_0262 3R AAAB01008980 11917991 11918005 +
ENSANGP00000014379 HFLFR JHU_0262 3R AAAB01008980 15798464 15798478 +
ENSANGP00000018505 HFLFR JHU_0262 3L AAAB01008848 1332378 1332392 +
ENSANGP00000015753 HFLFR JHU_0262 3R AAAB01008980 7914836 7914850 -
ENSANGP00000028855 HFLFR JHU_0262 2L AAAB01008807 3300175 3300289 -
ENSANGP00000015320 HFLFR JHU_0262 2R AAAB01008844 769939 769953 -
ENSANGP00000028159 HFLFR JHU_0262 3L AAAB01008966 1536065 1536079 -
ENSANGP00000001781 HFLFR JHU_0262 3L AAAB01008979 418680 418694 -
ENSANGP00000027006 HFLFR JHU_0262 3L AAAB01008979 418680 418694 -
ENSANGP00000025289 HFLFR JHU_0262 UNKN AAAB01008927 3029 3043 -
ENSANGP00000016267 HFLFR JHU_0262 3L AAAB01008933 1534483 1534797 -
ENSANGP00000012247 HFLFR JHU_0262 3R AAAB01008980 14702499 14702513 -
ENSANGP00000021368 HFLFR JHU_0262 3R AAAB01008984 2495129 2495143 -
ENSANGP00000013034  INVYYNEASGGK JHU_0268 3R AAAB01008944 1656552 1656587 -
ENSANGP00000002671 INVYYNEASGGK JHU_0268 3L AAAB01008823 1353364 1353399 +
AVLVDLEPGTMDSVR JHU_0270 3L AAAB01008823 1353412 1353456 +
ENSANGP00000019608
ENSANGP00000024132
AVLVDLEPGTMDSVR JHU_0270 2L AAAB01008810 353241 353285 +
ENSANGP00000003420/
ENSANGP00000026655 
YGFVVDGTR JHU_0271 2L AAAB01008968 640134 640160 -
ENSANGP00000009311/
ENSANGP00000028977/
ENSANGP00000027944/
ENSANGP00000026603/
ENSANGP00000026241/
ENSANGP00000029364
STVDKEELVQK JHU_0272 2L AAAB01008807 751603 751635 +
NLLSVAYK JHU_0273 2L AAAB01008807 751851 751874 +
YLAEVATGETR JHU_0274 2L AAAB01008807 752336 752368 +
SVTETGVELSNEER JHU_0275 2L AAAB01008807 751809 751850 +
ENSANGP00000009989/
ENSANGP00000024604
APGIIPR JHU_0238 2L AAAB01008900 1832858 1832878 +
QMSLLLR JHU_0277 2L AAAB01008900 1833440 1833460 +
AVDSLVPIGR JHU_0239 2L AAAB01008900 1832915 1832944 +
ALLQQIASEGK JHU_0240 2L AAAB01008900 1834034 1834066 +  
VVDALGNAIDGKGEIK JHU_0280 2L AAAB01008900 1832780 1832827 +
ENSANGP00000010360 LSKPATYDQIK JHU_0281 3R AAAB01008980 1009667 1009699 +
GAAQNIIPAATGAAK JHU_0282 3R AAAB01008980 1009523 1009567 +
ENSANGP00000011259 VVTATDEADLAR JHU_0283 3L AAAB01008816 2985709 2985744 +
ENSANGP00000021793 NADDISQEEYGEFYK JHU_0284 2L AAAB01008807 9106793 9106837 +
GVVDSEDLPLNISR JHU_0285 2L AAAB01008807 9107054 9107095 +
ENSANGP00000011832 TSFFQALSIPTK JHU_0286 2R AAAB01008888 1391240 1391275 -
ENSANGP00000012072 NLLSVAYK JHU_0273 2R AAAB01008987 15604012 15604035 +
DAAENSLVAYK JHU_0288 2R AAAB01008987 15604448 15604480 +
YLAEFATGGDRK JHU_0289 2R AAAB01008987 15604412 15604447 +
VASMDVELTVEER JHU_0290 2R AAAB01008987 15603973 15604011 +
ENSANGP00000012893 VSTGQGDKVFAPEEISAMVLGK JHU_0291 2R AAAB01008880 2050099 2050164 +
LTPDDIER JHU_0292 2R AAAB01008880 2051305 2051328 +
MKETAEAYLGK JHU_0293 2R AAAB01008880 2050165 2050197 +
NELESYAYSLK JHU_0294 2R AAAB01008880 2051395 2051427 +
ELEDIVQPIIAK JHU_0295 2R AAAB01008880 2051572 2051607 +
ITPSYVAFTADGER JHU_0296 2R AAAB01008880 2049892 2049933 +
AKFEELNMDLFR JHU_0297 2R AAAB01008880 2050681 2050716 +
NQLTTNPENTVFDAK JHU_0298 2R AAAB01008880 2049955 2049999 +
IINEPTAAAIAYGLDKK JHU_0299 2R AAAB01008880 2050300 2050350 +
VTHAVVTVPAYFNDAQR JHU_0300 2R AAAB01008880 2050201 2050251 +
ENSANGP00000022257 MKETAEAYLGK JHU_0293 2L AAAB01008948 1466713 1466745 -
IINEPTAAAIAYGLDKK JHU_0299 2L AAAB01008949 1466560 1466610 -
ENSANGP00000019887 MKETAEAYLGK JHU_0293 2R AAAB01008987 1393438 1393470 -
IINEPTAAAIAYGLDKK JHU_0299 2R AAAB01008988 1393285 1393335 -
ENSANGP00000015289 KPSYLQR JHU_0304 Unknown AAAB01008119 64809 64829 -
YGVQNQLR JHU_0305 Unknown AAAB01008119 64779 64802 -
SMVQNFDYTK JHU_0306 Unknown AAAB01008119 64830 64859 -
TLADETAQCMR JHU_0307 Unknown AAAB01008119 64455 64487 -
VTDLEASFYASFSYNCHDHDQYSMECLEAAEPK JHU_0308 Unknown AAAB01008119 64506 64604 -
ENSANGP00000021970 YGVQNQLR JHU_0305 3R AAAB01008964 5437017 5437040 +
SMVQNFDYTK JHU_0306 3R AAAB01008964 5436960 5436989 +
TLADETAQCMR JHU_0307 3R AAAB01008964 5437332 5437364 +
VTDLEASFYASFSYNCHDHDQYSMECLEAAEPK JHU_0308 3R AAAB01008964 5437215 5437313 +
ENSANGP00000016630 (NCBI)/
 ENSANGP00000024697(Ensembl)
TVISQSLSK JHU_0313 2R AAAB01008879 1843781 1843807 -
NMIGFYDMAR JHU_0314 2R AAAB01008879 1842846 1842875 -
LAEMPADSGYPAYLGAR JHU_0315 2R AAAB01008879 1843433 1843483 -
ENSANGP00000016676 LQCQDFLR JHU_0316 2R AAAB01008879 1578709 1578732 -
ENSANGP00000016863 VLDTGSPIR JHU_0317 3L AAAB01008986 4510641 4510667 +
IPVGAETLGR JHU_0318 3L AAAB01008986 4510668 4510697 +
VVDLLAPYAK JHU_0319 3L AAAB01008986 4510833 4510862 +
TIAMDGTEGLVR JHU_0320 3L AAAB01008986 4510596 4510631 +
IINVIGEPIDER JHU_0321 3L AAAB01008986 4510698 4510733 +
VALVYGQMNEPPGAR JHU_0322 3L AAAB01008986 4511061 4511105 +
IPSAVGYQPTLATDMGSMQER JHU_0323 3L  AAAB01008986  4511241 4511303 +
ENSANGP00000016868 VLDTGSPIR JHU_0317 3L AAAB01008986 4219359 4219385 +
IPVGAETLGR JHU_0318 3L AAAB01008986 4219386 4219415 +
VVDLLAPYAK JHU_0319 3L AAAB01008986 4219551 4219580 +
TIAMDGTEGLVR JHU_0320 3L AAAB01008986 4219314 4219349 +
IINVIGEPIDER JHU_0321 3L AAAB01008986 4219416 4219451 +
VALVYGQMNEPPGAR JHU_0322 3L AAAB01008986 4219779 4219823 +
IPSAVGYQPTLATDMGSMQER JHU_0323 3L AAAB01008986 4219959 4220021 +  
ENSANGP00000024137 VLDTGSPIR JHU_0317 3L AAAB01008986 4495918 4495944 +
IPVGAETLGR JHU_0318 3L AAAB01008986 4495945 4495974 +
VVDLLAPYAK JHU_0319 3L AAAB01008986 4496110 4496139 +
TIAMDGTEGLVR JHU_0320 3L AAAB01008986 4495873 4495908 +
IINVIGEPIDER JHU_0321 3L AAAB01008986 4495975 4496010 +
VALVYGQMNEPPGAR JHU_0322 3L AAAB01008986 4496338 4496382 +
IPSAVGYQPTLATDMGSMQER JHU_0323 3L AAAB01008986 4496518 4496580 +
ENSANGP00000017506 YTLYNVGSGPAVNVR JHU_0338 2L AAAB01008960 8697676 8697720 +
ENSANGP00000017682 FDWWER JHU_0339 2R AAAB01008987 786908 786925 -
TFMQLTAYR JHU_0340 2R AAAB01008987 785467 785493 -
GNFYQIYPR JHU_0341 2R AAAB01008987 786881 786907 -
TWLPVADGYR JHU_0342 2R AAAB01008987 785542 785571 -
GSAWQWSDKR JHU_0343 2R AAAB01008987 786379 786408 -
SFKDSDGDGIGDLK JHU_0344 2R AAAB01008987 786839 786880 -
ENSANGP00000018280 FVDLSR JHU_0345 3R AAAB01008964 3853492 3853509 -
TLNEANSR JHU_0346 3R AAAB01008964 3853606 3853629 -
VIDCIFR   JHU_0347 3R AAAB01008964 3853291 3853311 -
SDLEPEVR JHU_0127 3R  AAAB01008964 3853135 3853158 -
IYAAMPQIK   JHU_0349 3R AAAB01008964 3853429 3853455 -
KVIDCIFR   JHU_0350 3R AAAB01008964 3853291 3853314 -
SADYAFLLR  JHU_0351 3R AAAB01008964 3852997 3853023 -
IPVQHEAYK   JHU_0352 3R AAAB01008964 3853630 3853656 -
KIWGGYNKK     JHU_0353 3R AAAB01008964 3853366 3853392 -
LYHGTVEGAAK      JHU_0354 3R AAAB01008964 3853456 3853488 -
NAFDFHELR JHU_0355 3R AAAB01008964 3853024 3853050 -
GESFFAYCAK     JHU_0356 3R AAAB01008964 3853393 3853422 -
NYELSGSSQFK    JHU_0357 3R AAAB01008964 3853315 3853347 -
KLYHGTVEGAAK    JHU_0358 3R AAAB01008964 3853456 3853491 -
NYELSGSSQFKK    JHU_0359 3R AAAB01008964 3853312 3853347 -
CYEDHLPAGSSR    JHU_0360 3R AAAB01008964 3853848 3853883 -
ALDPEQALYVYK    JHU_0361 3R AAAB01008964 3853887 3853922 -
QKGESFFAYCAK   JHU_0362 3R AAAB01008964 3853393 3853428 -
SERIPVQHEAYK    JHU_0363 3R AAAB01008964 3853630 3853665 -
GRNYELSGSSQFK    JHU_0364 3R AAAB01008964 3853315 3853353 -
LEPNDAVTHCYAK JHU_0365 3R AAAB01008964 3853776 3853814 -
VYEGPEQVKEEMK JHU_0366 3R AAAB01008964 3852952 3852990 -
ALDPEQALYVYKR  JHU_0367 3R AAAB01008964 3853884 3853922 -
GRNYELSGSSQFKK JHU_0368 3R AAAB01008964 3853312 3853353 -
YMDDSGLKVDEVVR  JHU_0369 3R AAAB01008964 3855134 3855157 -
YMDDSGLKVDEVVR  JHU_0369 3R AAAB01008964 3853180 3853197 -
GKVYEGPEQVKEEMK JHU_0371 3R AAAB01008964 3852952 3852996 -
DFNLINKSDLEPEVR JHU_0142 3R AAAB01008964 3853135 3853179 -
SVLASCTGTQAYDYYSCLLNSPVKEDFK JHU_0373 3R AAAB01008964 3853051 3853134 -
SVLASCTGTQAYDYYSCLLNSPVKEDFKNAFDFHELR JHU_0374 3R AAAB01008964 3853024 3853134 -
ENSANGP00000018372 VETGVLKPGTVVVFAPVNLTTEVK JHU_0375 2L AAAB01008807 3024616 3024687 -
QLIVGVNK JHU_0376 2L AAAB01008807 3025024 3025047 -
TIEKFEK JHU_0377 2L AAAB01008807 3025354 3025374 -
QTVAVGVIK JHU_0378 2L AAAB01008807 3024169 3024195 -
EVSSYIKK JHU_0379 2L AAAB01008807 3024946 3024969 -
IGGIGTVPVGR JHU_0380 2L AAAB01008807 3024688 3024720 -  
TIEKFEKEAQEMGK JHU_0381 2L AAAB01008807 3025333 3025374 -
ENSANGP00000010498/
ENSANGP00000023203
QLIVGVNK JHU_0376 2R AAAB01008888 370283 370306 +
TIEKFEK JHU_0377 2R AAAB01008888 369956 369976 +
QTVAVGVIK JHU_0378 2R AAAB01008888 372059 372085 +
EVSSYIKK JHU_0379 2R AAAB01008888 370361 370384 +
IGGIGTVPVGR JHU_0380 2R AAAB01008888 370610 370642 +
TIEKFEKEAQEMGK JHU_0381 2R AAAB01008888 369956 369997 +
ENSANGP00000018531/
ENSANGP00000023637
IGSEVYHHLK JHU_0384 3R AAAB01008964 10913957 10913986 -
EALNLIQDAIAK JHU_0385 3R AAAB01008964 10913837 10913872 -
ENSANGP00000019238/
ENSANGP00000027418
LFEQFK JHU_0386 X AAAB01008846 234498 234515 +
LLPGADER JHU_0387 X AAAB01008846 233982 234005 +
DYPEYFAR JHU_0388 X AAAB01008846 234210 234233 +
QQWSAEGLDR JHU_0389 X AAAB01008846 234264 234293 +
GFPDYEALYK JHU_0390 X AAAB01008846 234525 234554 +
LPAYLSEVSAR JHU_0391 X AAAB01008846 233676 233708 +
VEEPLYETLK JHU_0392 X AAAB01008846 234234 234263 +
VEATVGQADAAVR JHU_0393 X AAAB01008846 234435 234473 +
MVSFPNALPVGVQR JHU_0394 X AAAB01008846 234294 234335 +
LAACVVSEHEQAYR JHU_0395 X AAAB01008846 233565 233606 +
LAHETGRVEATVGQADAAVR JHU_0396 X AAAB01008846 234414 234473 +
ALLETLLQHQGEQNNDVYLIR JHU_0397 X AAAB01008846 234351 234413 +
YKPDHAQYEGK JHU_0398 X AAAB01008846 234111 234143 +
WLAELQAGTFHEVVEFAR JHU_0399 X AAAB01008846 234156 234209 +
VEEPLYETLKQQWSAEGLDR JHU_0400 X AAAB01008846 234234 234293 +
VNVLQVSLQHDLPNLQEMVGEQR JHU_0401 X AAAB01008846 233709 233777 +
HLIEQAWQYGAQLQHELMLTSMESDR JHU_0402 X AAAB01008846 233778 233855 +
HLIEQAWQYGAQLQHELMLTSMESDRVQR JHU_0403 X AAAB01008846 233778 233864 +
ENSANGP00000020171 FVDIAIPCNTK JHU_0404 3L AAAB01008986 8791592 8791624 -
YAHYTQATPIAGR JHU_0405 3L AAAB01008986 8791784 8791822 -
ENSANGP00000020268 SERIVEQR JHU_0406 2L AAAB01008807 11041610 11041633 -
ENSANGP00000021830 MGLTEFQAVK JHU_0407 2L AAAB01008960 4054677 4054706 +
LEATADKYNLQVR JHU_0408 2L AAAB01008960 4054575 4054613 +
ENSANGP00000028522/
ENSANGP00000022344
SFVVGR JHU_0409 3R AAAB01008980 10833714 10833731 -
ELDDGLIER JHU_0410 3R AAAB01008980 10833429 10833455 -  
VDTKDKYLK JHU_0411 3R AAAB01008980 10833732 10833758 -
IKECFSSLDK JHU_0412 3R AAAB01008980 10833549 10833578 -
ECFSSLDKDVSAMVK JHU_0413 3R AAAB01008980 10833528 10833572 -
IKECFSSLDKDVSAMVK JHU_0414 3R AAAB01008980 10833528 10833578 -
EQELSDCIVDKR JHU_0415 3R AAAB01008980 10833393 10833428 -
LMNPTIDLVSTIEK JHU_0416 3R AAAB01008980 10833660 10833701 -
TNTSCGTEGTRELDDGLIER JHU_0417 3R AAAB01008980 10833429 10833488 -
ELDDGLIEREQELSDCIVDKR JHU_0418 3R AAAB01008980 10833393 10833455 -
ESEKSYEECSKDK JHU_0419 3R AAAB01008980 10833489 10833527 -
LMNPTIDLVSTIEKYSK JHU_0420 3R AAAB01008980 10833651 10833701 -
SYEECSKDKTNTSCGTEGTR JHU_0421 3R AAAB01008980 10833456 10833515 -
EGEEGAGSDDAVSGADDETEESKDDAEEDSEEGGEEGGDGASGGEGGEKESPR JHU_0422 3R AAAB01008980 10833893 10834033 -
EGEEGAGSDDAVSGADDETEESKDDAEEDSEEGGEEGGDGASGGEGGEKESPR JHU_0422 3R AAAB01008980 10833804 10833821 -
ENSANGP00000022839 YNYEFDKIPR JHU_0424 2L AAAB01008960 7922235 7922264 +
MTGVASGSLDSSGNVVQNTAR JHU_0425 2L AAAB01008960 7921203 7921265 +
ENSANGP00000023320/
ENSANGP00000024566/
ENSANGP00000017331
APDFVFFAPR JHU_0426 X AAAB01008846 1308947 1308976 -
ENSANGP00000024159/
ENSANGP00000024670/
ENSANGP00000025360/
ENSANGP00000012760
GILAADESTATCGK JHU_0427 2R AAAB01008859 8655703 8655744 -
GILAADESTATCGKR JHU_0428 2R AAAB01008859 8655700 8655744 -
TRIO protein SLNPASPTGSLGGK JHU_0429 2R AAAB01008987 12221068 12221109 -
SQNPASPAGSLGGK JHU_0430 2R AAAB01008987 12221068 12221109 -
Similar to SGS4
(ENSANGP00000029569)
SFASDGTDVTVR JHU_433 3R AAAB01008980  9141354 9141389 -  
D7-related 3 protein precursor
(ENSANGP00000025580)
CNAEAEKVHTSSK JHU_434 3R AAAB01008964  3838190 3838228 +
Putative 5'-nucleotidase precursor
(ENSANGP00000012716)
VPYDTKYDTVEGDYPLVVK JHU_435 3L  AAAB01008823    77693 77749 +  
Peroxidase precursor
(ENSANGP00000000593)
LLPAEYGDGVSVPR JHU_436 3L AAAB01008848 1353488 1353529 -
Novel protein coding gene AAAYCADPSLLFAR JHU_0431 2R AAAB01008987 3012881 3012922 -
MVVDGTFLR JHU_0432 2R AAAB01008987 3012836 3012862 -